SCOPe 2.06: Domain d2vxwc1: 2vxw C:10-68

Lineage for d2vxwc1 (2vxw C:10-68)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein automated matches [190403] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187277] (23 PDB entries)

8. Domain d2vxwc1: 2vxw C:10-68 [168927]
   Other proteins in same PDB: d2vxwa2, d2vxwb2, d2vxwc2, d2vxwd2
   automated match to d1hrja_

Details for d2vxwc1

PDB Entry: 2vxw, 1.7 Å

PDB Description: Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES

PDB Compounds: (C:) c-c motif chemokine 5

SCOPe Domain Sequences for d2vxwc1:

Sequence; same for both SEQRES and ATOM records:

>d2vxwc1 d.9.1.1 (C:10-68) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyinslems

Timeline for d2vxwc1:

• d2vxwc1 first appeared in SCOPe 2.01, called d2vxwc_
  
• d2vxwc1 was called d2vxwc_ in SCOPe 2.05
  
• d2vxwc1 appears in SCOPe 2.07
  
• d2vxwc1 appears in the current release, SCOPe 2.08