Lineage for d2vxwb_ (2vxw B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016266Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1016267Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1016268Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1016527Protein automated matches [190403] (2 species)
    not a true protein
  7. 1016528Species Human (Homo sapiens) [TaxId:9606] [187277] (5 PDB entries)
  8. 1016532Domain d2vxwb_: 2vxw B: [168926]
    automated match to d1hrja_

Details for d2vxwb_

PDB Entry: 2vxw (more details), 1.7 Å

PDB Description: Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
PDB Compounds: (B:) c-c motif chemokine 5

SCOPe Domain Sequences for d2vxwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxwb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fsplssqssaccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
eyinslems

SCOPe Domain Coordinates for d2vxwb_:

Click to download the PDB-style file with coordinates for d2vxwb_.
(The format of our PDB-style files is described here.)

Timeline for d2vxwb_: