![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.3: PHL pollen allergen [49590] (2 families) ![]() |
![]() | Family b.7.3.1: PHL pollen allergen [49591] (3 proteins) automatically mapped to Pfam PF01357 |
![]() | Protein automated matches [191014] (1 species) not a true protein |
![]() | Species Timothy grass (Phleum pratense) [TaxId:15957] [188781] (1 PDB entry) |
![]() | Domain d2vxqa_: 2vxq A: [168923] Other proteins in same PDB: d2vxqh_, d2vxql1, d2vxql2 automated match to d1bmwa_ |
PDB Entry: 2vxq (more details), 1.9 Å
SCOPe Domain Sequences for d2vxqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxqa_ b.7.3.1 (A:) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]} kvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseeplqg pfnfrfltekgmknvfddvvpekytigatyap
Timeline for d2vxqa_: