Lineage for d2vxqa_ (2vxq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773255Superfamily b.7.3: PHL pollen allergen [49590] (2 families) (S)
  5. 2773256Family b.7.3.1: PHL pollen allergen [49591] (3 proteins)
    automatically mapped to Pfam PF01357
  6. 2773266Protein automated matches [191014] (1 species)
    not a true protein
  7. 2773267Species Timothy grass (Phleum pratense) [TaxId:15957] [188781] (1 PDB entry)
  8. 2773268Domain d2vxqa_: 2vxq A: [168923]
    Other proteins in same PDB: d2vxqh_, d2vxql1, d2vxql2
    automated match to d1bmwa_

Details for d2vxqa_

PDB Entry: 2vxq (more details), 1.9 Å

PDB Description: crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
PDB Compounds: (A:) pollen allergen phl p 2

SCOPe Domain Sequences for d2vxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxqa_ b.7.3.1 (A:) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
kvtftvekgsnekhlavlvkyegdtmaevelrehgsdewvamtkgeggvwtfdseeplqg
pfnfrfltekgmknvfddvvpekytigatyap

SCOPe Domain Coordinates for d2vxqa_:

Click to download the PDB-style file with coordinates for d2vxqa_.
(The format of our PDB-style files is described here.)

Timeline for d2vxqa_: