Lineage for d2vxmc_ (2vxm C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133594Protein automated matches [190178] (2 species)
    not a true protein
  7. 2133595Species Cow (Bos taurus) [TaxId:9913] [188618] (2 PDB entries)
  8. 2133599Domain d2vxmc_: 2vxm C: [168920]
    automated match to d1fg5n_
    complexed with gol, mpd; mutant

Details for d2vxmc_

PDB Entry: 2vxm (more details), 2.82 Å

PDB Description: screening a limited structure-based library identifies udp-galnac-specific mutants of alpha-1,3 galactosyltransferase
PDB Compounds: (C:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d2vxmc_:

Sequence, based on SEQRES records: (download)

>d2vxmc_ c.68.1.9 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyraaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycw

Sequence, based on observed residues (ATOM records): (download)

>d2vxmc_ c.68.1.9 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpeqdismmrmk
tigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftyerrk
esaayipfgegdfyyraaifggtptqvlnitqecfkgilkdkkndieaqwhdeshlnkyf
llnkptkilspeycw

SCOPe Domain Coordinates for d2vxmc_:

Click to download the PDB-style file with coordinates for d2vxmc_.
(The format of our PDB-style files is described here.)

Timeline for d2vxmc_: