Lineage for d1ifaa_ (1ifa A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705815Protein Interferon-beta [47309] (2 species)
  7. 2705819Species Mouse (Mus musculus) [TaxId:10090] [47311] (4 PDB entries)
    Uniprot P01575 22-182
    CA-atoms only
  8. 2705823Domain d1ifaa_: 1ifa A: [16892]
    CA-atoms only
    complexed with asn

Details for d1ifaa_

PDB Entry: 1ifa (more details)

PDB Description: three-dimensional crystal structure of recombinant murine interferon- beta
PDB Compounds: (A:) interferon-beta

SCOPe Domain Sequences for d1ifaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ifaa_ a.26.1.3 (A:) Interferon-beta {Mouse (Mus musculus) [TaxId: 10090]}
ykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlqnv
flvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksyyw
rvqrylklmkynsyawmvvraeifrnfliirrltrnfq

SCOPe Domain Coordinates for d1ifaa_:

Click to download the PDB-style file with coordinates for d1ifaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ifaa_: