Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
Protein automated matches [190178] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [188618] (2 PDB entries) |
Domain d2vxmb_: 2vxm B: [168919] automated match to d1fg5n_ complexed with gol, mpd; mutant |
PDB Entry: 2vxm (more details), 2.82 Å
SCOPe Domain Sequences for d2vxmb_:
Sequence, based on SEQRES records: (download)
>d2vxmb_ c.68.1.9 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye rrkesaayipfgegdfyyraaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln kyfllnkptkilspeyc
>d2vxmb_ c.68.1.9 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpeismmrmkti gehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftyerrkes aayipfgegdfyyraaifggtptqvlnitqecfkgilkdkkndieaqwhdeshlnkyfll nkptkilspeyc
Timeline for d2vxmb_: