![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
![]() | Protein automated matches [190178] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [188618] (2 PDB entries) |
![]() | Domain d2vxma_: 2vxm A: [168918] automated match to d1fg5n_ complexed with gol, mpd; mutant |
PDB Entry: 2vxm (more details), 2.82 Å
SCOPe Domain Sequences for d2vxma_:
Sequence, based on SEQRES records: (download)
>d2vxma_ c.68.1.9 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye rrkesaayipfgegdfyyraaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln kyfllnkptkilspeycwdyhiglpadiklvkm
>d2vxma_ c.68.1.9 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpeismmrmkti gehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftyerrkes aayipfgegdfyyraaifggtptqvlnitqecfkgilkdkkndieaqwhdeshlnkyfll nkptkilspeycwdyhiglpadiklvkm
Timeline for d2vxma_: