Lineage for d2vx9a_ (2vx9 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229953Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 1229974Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 1229975Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
  6. 1229985Protein automated matches [190247] (4 species)
    not a true protein
  7. 1229990Species Halobacterium salinarum [TaxId:478009] [187023] (10 PDB entries)
  8. 1229994Domain d2vx9a_: 2vx9 A: [168892]
    automated match to d1moga_
    complexed with cl, na, rbf; mutant

Details for d2vx9a_

PDB Entry: 2vx9 (more details), 1.65 Å

PDB Description: h. salinarum dodecin e45a mutant
PDB Compounds: (A:) dodecin

SCOPe Domain Sequences for d2vx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vx9a_ d.230.2.1 (A:) automated matches {Halobacterium salinarum [TaxId: 478009]}
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigaveertyqtevqva
fel

SCOPe Domain Coordinates for d2vx9a_:

Click to download the PDB-style file with coordinates for d2vx9a_.
(The format of our PDB-style files is described here.)

Timeline for d2vx9a_: