| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) ![]() |
| Family c.1.12.0: automated matches [191427] (1 protein) not a true family |
| Protein automated matches [190614] (15 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188593] (2 PDB entries) |
| Domain d2vwtc_: 2vwt C: [168891] automated match to d1dxea_ complexed with gol, mg, po4, pyr |
PDB Entry: 2vwt (more details), 1.93 Å
SCOPe Domain Sequences for d2vwtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vwtc_ c.1.12.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnallsnpfkerlrkgevqiglwlssttaymaeiaatsgydwllidgehapntiqdlyhq
lqavapyasqpvirpvegskplikqvldigaqtllipmvdtaeqarqvvsatryppyger
gvgasvaraarwgrienymaqvndslcllvqvesktaldnldeildvegidgvfigpadl
saslgypdnaghpevqriietsirriraagkaagflavapdmaqqclawganfvavgvdt
mlysdaldqrlamfks
Timeline for d2vwtc_: