SCOPe 2.07: Domain d1au1a_: 1au1 A:

Lineage for d1au1a_ (1au1 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-beta [47309] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47310] (1 PDB entry)

8. Domain d1au1a_: 1au1 A: [16889]
   complexed with bgc, g6d, zn

Details for d1au1a_

PDB Entry: 1au1, 2.2 Å

PDB Description: human interferon-beta crystal structure

PDB Compounds: (A:) interferon-beta

SCOPe Domain Sequences for d1au1a_:

Sequence; same for both SEQRES and ATOM records:

>d1au1a_ a.26.1.3 (A:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]}
msynllgflqrssnfqcqkllwqlngrleyclkdrmnfdipeeikqlqqfqkedaaltiy
emlqnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmssl
hlkryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn

Timeline for d1au1a_:

• d1au1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1au1a_ appears in SCOPe 2.06
  
• d1au1a_ appears in the current release, SCOPe 2.08