| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
| Protein Interferon-beta [47309] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47310] (1 PDB entry) |
| Domain d1au1a_: 1au1 A: [16889] complexed with bgc, g6d, zn |
PDB Entry: 1au1 (more details), 2.2 Å
SCOPe Domain Sequences for d1au1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1au1a_ a.26.1.3 (A:) Interferon-beta {Human (Homo sapiens) [TaxId: 9606]}
msynllgflqrssnfqcqkllwqlngrleyclkdrmnfdipeeikqlqqfqkedaaltiy
emlqnifaifrqdssstgwnetivenllanvyhqinhlktvleeklekedftrgklmssl
hlkryygrilhylkakeyshcawtivrveilrnfyfinrltgylrn
Timeline for d1au1a_: