Lineage for d2vwta_ (2vwt A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100061Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2100415Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2100416Protein automated matches [190614] (15 species)
    not a true protein
  7. 2100472Species Escherichia coli K-12 [TaxId:83333] [188593] (2 PDB entries)
  8. 2100476Domain d2vwta_: 2vwt A: [168889]
    automated match to d1dxea_
    complexed with gol, mg, po4, pyr

Details for d2vwta_

PDB Entry: 2vwt (more details), 1.93 Å

PDB Description: crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex
PDB Compounds: (A:) yfau, 2-keto-3-deoxy sugar aldolase

SCOPe Domain Sequences for d2vwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vwta_ c.1.12.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnallsnpfkerlrkgevqiglwlssttaymaeiaatsgydwllidgehapntiqdlyhq
lqavapyasqpvirpvegskplikqvldigaqtllipmvdtaeqarqvvsatryppyger
gvgasvaraarwgrienymaqvndslcllvqvesktaldnldeildvegidgvfigpadl
saslgypdnaghpevqriietsirriraagkaagflavapdmaqqclawganfvavgvdt
mlysdaldqrlamfks

SCOPe Domain Coordinates for d2vwta_:

Click to download the PDB-style file with coordinates for d2vwta_.
(The format of our PDB-style files is described here.)

Timeline for d2vwta_: