![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) ![]() |
![]() | Family c.1.12.0: automated matches [191427] (1 protein) not a true family |
![]() | Protein automated matches [190614] (15 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [188593] (2 PDB entries) |
![]() | Domain d2vwta_: 2vwt A: [168889] automated match to d1dxea_ complexed with gol, mg, po4, pyr |
PDB Entry: 2vwt (more details), 1.93 Å
SCOPe Domain Sequences for d2vwta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vwta_ c.1.12.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mnallsnpfkerlrkgevqiglwlssttaymaeiaatsgydwllidgehapntiqdlyhq lqavapyasqpvirpvegskplikqvldigaqtllipmvdtaeqarqvvsatryppyger gvgasvaraarwgrienymaqvndslcllvqvesktaldnldeildvegidgvfigpadl saslgypdnaghpevqriietsirriraagkaagflavapdmaqqclawganfvavgvdt mlysdaldqrlamfks
Timeline for d2vwta_: