Lineage for d2vwra1 (2vwr A:336-428)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2380194Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2380195Protein automated matches [190436] (8 species)
    not a true protein
  7. 2380209Species Human (Homo sapiens) [TaxId:9606] [187333] (101 PDB entries)
  8. 2380216Domain d2vwra1: 2vwr A:336-428 [168885]
    Other proteins in same PDB: d2vwra2
    automated match to d1iu0a_

Details for d2vwra1

PDB Entry: 2vwr (more details), 1.3 Å

PDB Description: crystal structure of the second pdz domain of numb-binding protein 2
PDB Compounds: (A:) ligand of numb protein x 2

SCOPe Domain Sequences for d2vwra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vwra1 b.36.1.0 (A:336-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eilqvalhkrdsgeqlgiklvrrtdepgvfildllegglaaqdgrlssndrvlainghdl
kygtpelaaqiiqasgervnltiarpgkpeiel

SCOPe Domain Coordinates for d2vwra1:

Click to download the PDB-style file with coordinates for d2vwra1.
(The format of our PDB-style files is described here.)

Timeline for d2vwra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vwra2