![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries) |
![]() | Domain d2vwna_: 2vwn A: [168881] Other proteins in same PDB: d2vwnl_ automated match to d1c5md_ complexed with ca, cl, h25, na |
PDB Entry: 2vwn (more details), 1.61 Å
SCOPe Domain Sequences for d2vwna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vwna_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr
Timeline for d2vwna_: