Lineage for d1vlk__ (1vlk -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins) Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (2 species) 
Species Epstein-Barr virus [TaxId:10376] [47308] (1 PDB entry) 
Domain d1vlk__: 1vlk - [16888]
Details for d1vlk__
PDB Entry: 1vlk (more details), 1.9 Å
PDB Description: structure of viral interleukin-10
SCOP Domain Sequences for d1vlk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlk__ a.26.1.3 (-) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus}
cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee
vmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg
iykamsefdifinyieaymtik
SCOP Domain Coordinates for d1vlk__:
Click to download the PDB-style file with coordinates for d1vlk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vlk__:
- d1vlk__ appears in SCOP 1.57
- d1vlk__ appears in the current release, SCOPe 2.08, called d1vlka_
View in 3D