Lineage for d1vlk__ (1vlk -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2754Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (6 proteins)
  6. 2801Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (2 species)
  7. 2802Species Epstein-Barr virus [TaxId:10376] [47308] (1 PDB entry)
  8. 2803Domain d1vlk__: 1vlk - [16888]

Details for d1vlk__

PDB Entry: 1vlk (more details), 1.9 Å

PDB Description: structure of viral interleukin-10

SCOP Domain Sequences for d1vlk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlk__ a.26.1.3 (-) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus}
cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee
vmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg
iykamsefdifinyieaymtik

SCOP Domain Coordinates for d1vlk__:

Click to download the PDB-style file with coordinates for d1vlk__.
(The format of our PDB-style files is described here.)

Timeline for d1vlk__: