SCOPe 2.08: Domain d1vlka_: 1vlk A:

Lineage for d1vlka_ (1vlk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Epstein-Barr virus [TaxId:10376] [47308] (3 PDB entries)

8. Domain d1vlka_: 1vlk A: [16888]

Details for d1vlka_

PDB Entry: 1vlk, 1.9 Å

PDB Description: structure of viral interleukin-10

PDB Compounds: (A:) viral interleukin-10

SCOPe Domain Sequences for d1vlka_:

Sequence; same for both SEQRES and ATOM records:

>d1vlka_ a.26.1.3 (A:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Epstein-Barr virus [TaxId: 10376]}
cdnfpqmlrdlrdafsrvktffqtkdevdnlllkeslledfkgylgcqalsemiqfylee
vmpqaenqdpeakdhvnslgenlktlrlrlrrchrflpcenkskaveqiknafnklqekg
iykamsefdifinyieaymtik

Timeline for d1vlka_:

• d1vlka_ first appeared (with stable ids) in SCOP 1.55, called d1vlk__
  
• d1vlka_ appears in SCOPe 2.07