Lineage for d2vwla_ (2vwl A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319957Protein automated matches [190044] (14 species)
    not a true protein
  7. 1319996Species Human (Homo sapiens) [TaxId:9606] [187233] (129 PDB entries)
  8. 1320039Domain d2vwla_: 2vwl A: [168875]
    Other proteins in same PDB: d2vwll_
    automated match to d1c5md_
    complexed with ca, cl, lzh, na

Details for d2vwla_

PDB Entry: 2vwl (more details), 1.8 Å

PDB Description: aminopyrrolidine factor xa inhibitor
PDB Compounds: (A:) activated factor xa heavy chain

SCOPe Domain Sequences for d2vwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vwla_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr

SCOPe Domain Coordinates for d2vwla_:

Click to download the PDB-style file with coordinates for d2vwla_.
(The format of our PDB-style files is described here.)

Timeline for d2vwla_: