SCOPe 2.08: Domain d2vw8a1: 2vw8 A:1-298

Lineage for d2vw8a1 (2vw8 A:1-298)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.14: PqsE-like [160864] (2 proteins)
   part of Pfam PF00753; extended C-terminal region with extra helices

6. Protein automated matches [191054] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189394] (1 PDB entry)

8. Domain d2vw8a1: 2vw8 A:1-298 [168874]
   Other proteins in same PDB: d2vw8a2
   automated match to d2q0ja1
   complexed with cac, edo, fe2

Details for d2vw8a1

PDB Entry: 2vw8, 1.45 Å

PDB Description: crystal structure of quinolone signal response protein pqse from pseudomonas aeruginosa

PDB Compounds: (A:) pa1000

SCOPe Domain Sequences for d2vw8a1:

Sequence; same for both SEQRES and ATOM records:

>d2vw8a1 d.157.1.14 (A:1-298) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mlrlsapgqldddlcllgdvqvpvfllrlgeaswalveggisrdaelvwadlcrwvadps
qvhywlithkhydhcgllpylcprlpnvqvlasertcqawksesavrvverlnrqllrae
qrlpeacawdalpvravadgewlelgprhrlqvieahghsddhvvfydvrrrrlfcgdal
gefdeaegvwrplvfddmeayleslerlqrlptllqlipghggllrgrlaadgaesayte
clrlcrrllwrqsmgesldelseelhrawggqsvdflpgelhlgsmrrmleilsrqal

Timeline for d2vw8a1:

• d2vw8a1 first appeared in SCOPe 2.01, called d2vw8a_
  
• d2vw8a1 appears in SCOPe 2.07