| Class b: All beta proteins [48724] (178 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein automated matches [190044] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries) |
| Domain d2vvva_: 2vvv A: [168872] Other proteins in same PDB: d2vvvl_ automated match to d1c5md_ complexed with ca, h21, na |
PDB Entry: 2vvv (more details), 1.73 Å
SCOPe Domain Sequences for d2vvva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vvva_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Timeline for d2vvva_: