SCOPe 2.01: Domain d2vvva_: 2vvv A:

Lineage for d2vvva_ (2vvv A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries)

8. Domain d2vvva_: 2vvv A: [168872]
   Other proteins in same PDB: d2vvvl_
   automated match to d1c5md_
   complexed with ca, h21, na

Details for d2vvva_

PDB Entry: 2vvv, 1.73 Å

PDB Description: aminopyrrolidine-related triazole factor xa inhibitor

PDB Compounds: (A:) activated factor xa heavy chain

SCOPe Domain Sequences for d2vvva_:

Sequence; same for both SEQRES and ATOM records:

>d2vvva_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt

Timeline for d2vvva_:

• d2vvva_ is new in SCOPe 2.01-stable
  
• d2vvva_ appears in SCOPe 2.02
  
• d2vvva_ appears in the current release, SCOPe 2.08