SCOPe 2.08: Domain d2vvka1: 2vvk A:3-56

Lineage for d2vvka1 (2vvk A:3-56)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d2vvka1: 2vvk A:3-56 [168869]
   Other proteins in same PDB: d2vvka2
   automated match to d1gcqb_
   complexed with gol

Details for d2vvka1

PDB Entry: 2vvk, 1.6 Å

PDB Description: grb2 sh3c (1)

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d2vvka1:

Sequence; same for both SEQRES and ATOM records:

>d2vvka1 b.34.2.1 (A:3-56) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvn

Timeline for d2vvka1:

• d2vvka1 first appeared in SCOPe 2.01, called d2vvka_
  
• d2vvka1 was called d2vvka_ in SCOPe 2.07