Lineage for d2vvka1 (2vvk A:3-56)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783282Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)
  8. 2783296Domain d2vvka1: 2vvk A:3-56 [168869]
    Other proteins in same PDB: d2vvka2
    automated match to d1gcqb_
    complexed with gol

Details for d2vvka1

PDB Entry: 2vvk (more details), 1.6 Å

PDB Description: grb2 sh3c (1)
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d2vvka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvka1 b.34.2.1 (A:3-56) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvn

SCOPe Domain Coordinates for d2vvka1:

Click to download the PDB-style file with coordinates for d2vvka1.
(The format of our PDB-style files is described here.)

Timeline for d2vvka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vvka2