Lineage for d2vvid_ (2vvi D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199567Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1199568Protein automated matches [190526] (11 species)
    not a true protein
  7. 1199636Species Lobophyllia hemprichii [TaxId:46758] [187486] (9 PDB entries)
  8. 1199656Domain d2vvid_: 2vvi D: [168864]
    automated match to d1mova_
    complexed with so3, so4

Details for d2vvid_

PDB Entry: 2vvi (more details), 2 Å

PDB Description: irisfp fluorescent protein in its green form, trans conformation
PDB Compounds: (D:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d2vvid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvid_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpd

SCOPe Domain Coordinates for d2vvid_:

Click to download the PDB-style file with coordinates for d2vvid_.
(The format of our PDB-style files is described here.)

Timeline for d2vvid_: