![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species) intertwined dimer, similar to interferon-gamma |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47307] (6 PDB entries) |
![]() | Domain d1ilka_: 1ilk A: [16886] |
PDB Entry: 1ilk (more details), 1.8 Å
SCOPe Domain Sequences for d1ilka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ilka_ a.26.1.3 (A:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]} nscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemi qfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafn klqekgiykamsefdifinyieaymtmkirn
Timeline for d1ilka_: