Lineage for d2vvhc_ (2vvh C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643884Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1643885Protein automated matches [190526] (18 species)
    not a true protein
  7. 1644045Species Lobophyllia hemprichii [TaxId:46758] [187486] (12 PDB entries)
  8. 1644048Domain d2vvhc_: 2vvh C: [168859]
    automated match to d1mova_
    complexed with so3, so4

Details for d2vvhc_

PDB Entry: 2vvh (more details), 1.8 Å

PDB Description: irisfp fluorescent protein in its green form, cis conformation
PDB Compounds: (C:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d2vvhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvhc_ d.22.1.0 (C:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d2vvhc_:

Click to download the PDB-style file with coordinates for d2vvhc_.
(The format of our PDB-style files is described here.)

Timeline for d2vvhc_: