Lineage for d2vvga_ (2vvg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114169Species Giardia intestinalis [TaxId:5741] [188490] (1 PDB entry)
  8. 2114170Domain d2vvga_: 2vvg A: [168855]
    automated match to d1goja_
    complexed with adp, mg

Details for d2vvga_

PDB Entry: 2vvg (more details), 1.6 Å

PDB Description: crystal structure of the g.intestinalis kinesin 2 gikin2a motor domain
PDB Compounds: (A:) kinesin-2

SCOPe Domain Sequences for d2vvga_:

Sequence, based on SEQRES records: (download)

>d2vvga_ c.37.1.0 (A:) automated matches {Giardia intestinalis [TaxId: 5741]}
dnikvivrcrplnaretrenalniirmdeasaqvivdppeqeksatqakkvprtftfdav
ydqtscnygifqasfkplidavlegfnstifaygqtgagktwtmggnkeepgaipnsfkh
lfdainssssnqnflvigsylelyneeirdliknntklplkedktrgiyvdglsmhrvtt
aaelsalmdkgfanrhvaatqmndtssrshsifmvriecsevienkevirvgklnlvdla
gserqsktgatgetlvegakinlslsalglvisklvegathipyrdskltrllqdslggn
sktlmcanispastnydetmstlryadrakqiknkprinedpkdaqi

Sequence, based on observed residues (ATOM records): (download)

>d2vvga_ c.37.1.0 (A:) automated matches {Giardia intestinalis [TaxId: 5741]}
dnikvivrcrplnaretrenalniirmdeasaqvivdpprtftfdavydqtscnygifqa
sfkplidavlegfnstifaygqtgagktwtmggnkeepgaipnsfkhlfdainssssnqn
flvigsylelyneeirdliknntklplkedktrgiyvdglsmhrvttaaelsalmdkgfa
nrhssrshsifmvriecsevievirvgklnlvdlagserqkinlslsalglvisklvega
thipyrdskltrllqdslggnsktlmcanispastnydetmstlryadrakqiknkprin
edpkdaqi

SCOPe Domain Coordinates for d2vvga_:

Click to download the PDB-style file with coordinates for d2vvga_.
(The format of our PDB-style files is described here.)

Timeline for d2vvga_: