Lineage for d2vvca_ (2vvc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406399Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)
  8. 2406544Domain d2vvca_: 2vvc A: [168851]
    Other proteins in same PDB: d2vvck_, d2vvcl_
    automated match to d1c5md_
    complexed with ca, lzf, na

Details for d2vvca_

PDB Entry: 2vvc (more details), 1.95 Å

PDB Description: aminopyrrolidine factor xa inhibitor
PDB Compounds: (A:) activated factor xa heavy chain

SCOPe Domain Sequences for d2vvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vvca_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmk

SCOPe Domain Coordinates for d2vvca_:

Click to download the PDB-style file with coordinates for d2vvca_.
(The format of our PDB-style files is described here.)

Timeline for d2vvca_: