SCOP 1.75: Domain d2ilka_: 2ilk A:

Lineage for d2ilka_ (2ilk A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Human (Homo sapiens) [TaxId:9606] [47307] (7 PDB entries)

8. Domain d2ilka_: 2ilk A: [16885]
   complexed with so4

Details for d2ilka_

PDB Entry: 2ilk, 1.6 Å

PDB Description: crystal structure of human interleukin-10 at 1.6 angstroms resolution

PDB Compounds: (A:) interleukin-10

SCOP Domain Sequences for d2ilka_:

Sequence; same for both SEQRES and ATOM records:

>d2ilka_ a.26.1.3 (A:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]}
tqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqal
semiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvk
nafnklqekgiykamsefdifinyieaymtmkirn

Timeline for d2ilka_:

• d2ilka_ first appeared (with stable ids) in SCOP 1.55, called d2ilk__
  
• d2ilka_ appears in SCOP 1.73
  
• d2ilka_ appears in SCOPe 2.01
  
• d2ilka_ appears in the current release, SCOPe 2.08