Lineage for d2ilk__ (2ilk -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536620Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 536621Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 536777Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 536824Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
    intertwined dimer, similar to interferon-gamma
  7. 536827Species Human (Homo sapiens) [TaxId:9606] [47307] (5 PDB entries)
  8. 536828Domain d2ilk__: 2ilk - [16885]
    complexed with so4

Details for d2ilk__

PDB Entry: 2ilk (more details), 1.6 Å

PDB Description: crystal structure of human interleukin-10 at 1.6 angstroms resolution

SCOP Domain Sequences for d2ilk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ilk__ a.26.1.3 (-) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens)}
tqsenscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqal
semiqfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvk
nafnklqekgiykamsefdifinyieaymtmkirn

SCOP Domain Coordinates for d2ilk__:

Click to download the PDB-style file with coordinates for d2ilk__.
(The format of our PDB-style files is described here.)

Timeline for d2ilk__: