![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.2: Heme-binding PAS domain [55789] (3 proteins) |
![]() | Protein Histidine kinase FixL heme domain [55790] (2 species) |
![]() | Species Bradyrhizobium japonicum [TaxId:375] [55792] (19 PDB entries) Uniprot P23222 152-270 |
![]() | Domain d2vv7a_: 2vv7 A: [168840] automated match to d1drma_ complexed with cl, hem, na |
PDB Entry: 2vv7 (more details), 1.81 Å
SCOPe Domain Sequences for d2vv7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vv7a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} pdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsd phiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlt
Timeline for d2vv7a_: