SCOP 1.75: Domain d1irla_: 1irl A:

Lineage for d1irla_ (1irl A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (13 proteins)

6. Protein Interleukin-2 (IL-2) [47301] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47302] (14 PDB entries)

8. Domain d1irla_: 1irl A: [16883]
   mutant

Details for d1irla_

PDB Entry: 1irl

PDB Description: the solution structure of the f42a mutant of human interleukin 2

PDB Compounds: (A:) interleukin-2

SCOP Domain Sequences for d1irla_:

Sequence; same for both SEQRES and ATOM records:

>d1irla_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle
eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr
witfcqsiistlt

Timeline for d1irla_:

• d1irla_ first appeared (with stable ids) in SCOP 1.55, called d1irl__
  
• d1irla_ appears in SCOP 1.73
  
• d1irla_ appears in SCOPe 2.01
  
• d1irla_ appears in the current release, SCOPe 2.08