Lineage for d2vu5a_ (2vu5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951429Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188810] (1 PDB entry)
  8. 2951430Domain d2vu5a_: 2vu5 A: [168827]
    automated match to d1jxva_

Details for d2vu5a_

PDB Entry: 2vu5 (more details), 2 Å

PDB Description: crystal structure of pndk from bacillus anthracis
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2vu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vu5a_ d.58.6.1 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mektflmvkpdgvqrafigeivarfekkgfqlvgaklmqvtpeiagqhyaeheekpffge
lvdfitsgpvfamvwqgegvvdtarnmmgktrpheaapgtirgdfgvtvakniihgsdsl
esaereigiffkeeelvdysklmnewiy

SCOPe Domain Coordinates for d2vu5a_:

Click to download the PDB-style file with coordinates for d2vu5a_.
(The format of our PDB-style files is described here.)

Timeline for d2vu5a_: