Lineage for d2vtxd_ (2vtx D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966111Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 966210Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 966211Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
  6. 966248Protein automated matches [190762] (2 species)
    not a true protein
  7. 966249Species African clawed frog (Xenopus laevis) [TaxId:8355] [188719] (1 PDB entry)
  8. 966253Domain d2vtxd_: 2vtx D: [168819]
    automated match to d1k5ja_

Details for d2vtxd_

PDB Entry: 2vtx (more details), 2.5 Å

PDB Description: activation of nucleoplasmin, an oligomeric histone chaperone, challenges its stability
PDB Compounds: (D:) npm-a protein

SCOPe Domain Sequences for d2vtxd_:

Sequence, based on SEQRES records: (download)

>d2vtxd_ b.121.3.1 (D:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
liwgcelneqnktfefkveddeekcehqlalrtvclgdkakdefhiveivdqeegaeksv
piatlkpsilpmatmvgieldppvtfrlkagsgplyisgqhv

Sequence, based on observed residues (ATOM records): (download)

>d2vtxd_ b.121.3.1 (D:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
liwgcelneqnktfefkvhqlalrtvclgdkakdefhiveivdqksvpiatlkpsilpma
tmvgieldppvtfrlkagsgplyisgqhv

SCOPe Domain Coordinates for d2vtxd_:

Click to download the PDB-style file with coordinates for d2vtxd_.
(The format of our PDB-style files is described here.)

Timeline for d2vtxd_: