SCOPe 2.03: Domain d3inkc_: 3ink C:

Lineage for d3inkc_ (3ink C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-2 (IL-2) [47301] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47302] (15 PDB entries)

8. Domain d3inkc_: 3ink C: [16881]

Details for d3inkc_

PDB Entry: 3ink, 2.5 Å

PDB Description: unraveling the structure of interleukin-2: reply

PDB Compounds: (C:) interleukin-2

SCOPe Domain Sequences for d3inkc_:

Sequence, based on SEQRES records:

>d3inkc_ a.26.1.2 (C:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfa
qsiistlt

Sequence, based on observed residues (ATOM records):

>d3inkc_ a.26.1.2 (C:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgceyadetativeflnrwitfaqsiist
lt

Timeline for d3inkc_:

• d3inkc_ first appeared (with stable ids) in SCOP 1.55
  
• d3inkc_ appears in SCOPe 2.02
  
• d3inkc_ appears in SCOPe 2.04
  
• d3inkc_ appears in the current release, SCOPe 2.08