Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Stem cell factor, SCF [47299] (1 species) forms dimer similar to the M-CSF and Flt3 ligand dimers |
Species Human (Homo sapiens) [TaxId:9606] [47300] (3 PDB entries) |
Domain d1exzd_: 1exz D: [16880] complexed with ca, sm, trs |
PDB Entry: 1exz (more details), 2.3 Å
SCOPe Domain Sequences for d1exzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exzd_ a.26.1.2 (D:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]} tnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnise glsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsidafkd fvva
Timeline for d1exzd_: