SCOPe 2.05: Domain d1exzd_: 1exz D:

Lineage for d1exzd_ (1exz D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Stem cell factor, SCF [47299] (1 species)
   forms dimer similar to the M-CSF and Flt3 ligand dimers

7. Species Human (Homo sapiens) [TaxId:9606] [47300] (3 PDB entries)

8. Domain d1exzd_: 1exz D: [16880]
   complexed with ca, sm, trs

Details for d1exzd_

PDB Entry: 1exz, 2.3 Å

PDB Description: structure of stem cell factor

PDB Compounds: (D:) stem cell factor

SCOPe Domain Sequences for d1exzd_:

Sequence; same for both SEQRES and ATOM records:

>d1exzd_ a.26.1.2 (D:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
tnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnise
glsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsidafkd
fvva

Timeline for d1exzd_:

• d1exzd_ first appeared (with stable ids) in SCOP 1.55
  
• d1exzd_ appears in SCOPe 2.04
  
• d1exzd_ appears in SCOPe 2.06
  
• d1exzd_ appears in the current release, SCOPe 2.08