Lineage for d2vsmb_ (2vsm B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367929Family b.6.1.5: Ephrin ectodomain [74874] (3 protein domains)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 2367945Protein automated matches [190316] (1 species)
    not a true protein
  7. 2367946Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries)
  8. 2367947Domain d2vsmb_: 2vsm B: [168790]
    automated match to d1ikop_
    complexed with ipa, nag

Details for d2vsmb_

PDB Entry: 2vsm (more details), 1.8 Å

PDB Description: nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
PDB Compounds: (B:) ephrin-b2

SCOPe Domain Sequences for d2vsmb_:

Sequence, based on SEQRES records: (download)

>d2vsmb_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvghh

Sequence, based on observed residues (ATOM records): (download)

>d2vsmb_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdvgqyeyykvymvdkdqadrct
ikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqeg
gvcqtramkilmkvghh

SCOPe Domain Coordinates for d2vsmb_:

Click to download the PDB-style file with coordinates for d2vsmb_.
(The format of our PDB-style files is described here.)

Timeline for d2vsmb_: