SCOPe 2.08: Domain d2vsmb1: 2vsm B:31-168

Lineage for d2vsmb1 (2vsm B:31-168)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
   eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
   automatically mapped to Pfam PF00812

6. Protein automated matches [190316] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries)

8. Domain d2vsmb1: 2vsm B:31-168 [168790]
   Other proteins in same PDB: d2vsmb2
   automated match to d1ikop_
   complexed with ipa, nag

Details for d2vsmb1

PDB Entry: 2vsm, 1.8 Å

PDB Description: nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinb2

PDB Compounds: (B:) ephrin-b2

SCOPe Domain Sequences for d2vsmb1:

Sequence, based on SEQRES records:

>d2vsmb1 b.6.1.5 (B:31-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
rctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldn
qeggvcqtramkilmkvg

Sequence, based on observed residues (ATOM records):

>d2vsmb1 b.6.1.5 (B:31-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivlepiywnssnskflpgqglvlypqigdkldiicpkvdvgqyeyykvymvdkdqadrct
ikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqeg
gvcqtramkilmkvg

Timeline for d2vsmb1:

• d2vsmb1 first appeared in SCOPe 2.01, called d2vsmb_
  
• d2vsmb1 was called d2vsmb_ in SCOPe 2.07