![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
![]() | Protein automated matches [190951] (34 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [188718] (2 PDB entries) |
![]() | Domain d2vsha_: 2vsh A: [168786] automated match to d1vpaa_ complexed with 1pe, ca, p6g, peg, pg4 |
PDB Entry: 2vsh (more details), 2 Å
SCOPe Domain Sequences for d2vsha_:
Sequence, based on SEQRES records: (download)
>d2vsha_ c.68.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} hmiyagilaggtgtrmgisnlpkqflelgdrpilihtiekfvlepsiekivvgvhgdwvs haedlvdkylplykeriiitkggadrntsikniieaidayrpltpedivvthdsvrpfit lrmiqdniqlaqnhdavdtvveavdtivestngqfitdipnrahlyqgqtpqtfrckdfm dlygslsdeekeiltdackifvikgkdvalakgeysnlkittvtdlkiaksmie
>d2vsha_ c.68.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} hmiyagilagpkqflelgdrpilihtiekfvlepsiekivvgvhgdwvshaedlvdkylp lykeriiitkggadrntsikniieaidayrpltpedivvthdsvrpfitlrmiqdniqla qnhdavdtvveavdtivestngqfitdipnrahlyqgqtpqtfrckdfmdlygslsdeek eiltdackifvikgkdvalakgeysnlkittvtdlkiaksmie
Timeline for d2vsha_: