Lineage for d2vs3b_ (2vs3 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149926Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2149927Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)
  7. 2149928Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
    Uniprot P14769
  8. 2149956Domain d2vs3b_: 2vs3 B: [168781]
    automated match to d1g8oa_
    complexed with mn, nlc, udp; mutant

Details for d2vs3b_

PDB Entry: 2vs3 (more details), 2.2 Å

PDB Description: the binding of udp-galactose by an active site mutant of alpha-1,3 galactosyltransferase (alpha3gt)
PDB Compounds: (B:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d2vs3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vs3b_ c.68.1.9 (B:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhneshln
kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv

SCOPe Domain Coordinates for d2vs3b_:

Click to download the PDB-style file with coordinates for d2vs3b_.
(The format of our PDB-style files is described here.)

Timeline for d2vs3b_: