Lineage for d2vs2a_ (2vs2 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 956278Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 956765Protein automated matches [190156] (3 species)
    not a true protein
  7. 956766Species Cryphonectria parasitica [TaxId:5116] [187236] (21 PDB entries)
  8. 956787Domain d2vs2a_: 2vs2 A: [168779]
    automated match to d1e5oe_
    complexed with 0qs, dod

Details for d2vs2a_

PDB Entry: 2vs2 (more details), 2 Å

PDB Description: neutron diffraction structure of endothiapepsin in complex with a gem- diol inhibitor.
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d2vs2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vs2a_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d2vs2a_:

Click to download the PDB-style file with coordinates for d2vs2a_.
(The format of our PDB-style files is described here.)

Timeline for d2vs2a_: