SCOPe 2.08: Domain d2vrxa_: 2vrx A:

Lineage for d2vrxa_ (2vrx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries)

8. Domain d2vrxa_: 2vrx A: [168777]
   automated match to d1ol5a_
   complexed with 447

Details for d2vrxa_

PDB Entry: 2vrx, 1.86 Å

PDB Description: structure of aurora b kinase in complex with zm447439

PDB Compounds: (A:) serine/threonine-protein kinase 12-a

SCOPe Domain Sequences for d2vrxa_:

Sequence; same for both SEQRES and ATOM records:

>d2vrxa_ d.144.1.7 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth
dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry
hppqrlplkgvmehpwvkansrrvlppvy

Timeline for d2vrxa_:

• d2vrxa_ first appeared in SCOPe 2.01
  
• d2vrxa_ appears in SCOPe 2.07