Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (6 species) not a true protein |
Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (1 PDB entry) |
Domain d2vrpa_: 2vrp A: [168775] automated match to d1y17a1 complexed with cl, na |
PDB Entry: 2vrp (more details), 2.41 Å
SCOPe Domain Sequences for d2vrpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrpa_ d.169.1.1 (A:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} dcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqkde ladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvnyyc eqmhafvckllpy
Timeline for d2vrpa_: