Lineage for d2vrpa_ (2vrp A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226728Protein automated matches [190329] (6 species)
    not a true protein
  7. 1226743Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (1 PDB entry)
  8. 1226744Domain d2vrpa_: 2vrp A: [168775]
    automated match to d1y17a1
    complexed with cl, na

Details for d2vrpa_

PDB Entry: 2vrp (more details), 2.41 Å

PDB Description: structure of rhodocytin
PDB Compounds: (A:) Aggretin alpha chain

SCOPe Domain Sequences for d2vrpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrpa_ d.169.1.1 (A:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
dcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqkde
ladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvnyyc
eqmhafvckllpy

SCOPe Domain Coordinates for d2vrpa_:

Click to download the PDB-style file with coordinates for d2vrpa_.
(The format of our PDB-style files is described here.)

Timeline for d2vrpa_: