Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (6 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [188648] (1 PDB entry) |
Domain d2vrnb_: 2vrn B: [168774] automated match to d1oi4a1 complexed with mg |
PDB Entry: 2vrn (more details), 2.15 Å
SCOPe Domain Sequences for d2vrnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrnb_ c.23.16.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]} dltgkkiailaadgveeieltspraaieaaggttelislepgeiqsmkgdiepqekyrvd hvvsevqvsdydglllpggtvnpdklrleegamkfvrdmydagkpiaaichgpwslsetg iaqglkmtswsslkreltlagaqwvdeecvtdkgvvtsrkpddlpafnkkiveefaegdh ssrrk
Timeline for d2vrnb_: