SCOPe 2.01: Domain d2vrnb_: 2vrn B:

Lineage for d2vrnb_ (2vrn B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (6 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [188648] (1 PDB entry)

8. Domain d2vrnb_: 2vrn B: [168774]
   automated match to d1oi4a1
   complexed with mg

Details for d2vrnb_

PDB Entry: 2vrn, 2.15 Å

PDB Description: the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily

PDB Compounds: (B:) protease I

SCOPe Domain Sequences for d2vrnb_:

Sequence; same for both SEQRES and ATOM records:

>d2vrnb_ c.23.16.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
dltgkkiailaadgveeieltspraaieaaggttelislepgeiqsmkgdiepqekyrvd
hvvsevqvsdydglllpggtvnpdklrleegamkfvrdmydagkpiaaichgpwslsetg
iaqglkmtswsslkreltlagaqwvdeecvtdkgvvtsrkpddlpafnkkiveefaegdh
ssrrk

Timeline for d2vrnb_:

• d2vrnb_ is new in SCOPe 2.01-stable
  
• d2vrnb_ appears in SCOPe 2.02
  
• d2vrnb_ appears in the current release, SCOPe 2.08