| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (18 species) not a true protein |
| Species Deinococcus radiodurans [TaxId:243230] [188648] (1 PDB entry) |
| Domain d2vrna_: 2vrn A: [168773] automated match to d1oi4a1 complexed with mg |
PDB Entry: 2vrn (more details), 2.15 Å
SCOPe Domain Sequences for d2vrna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrna_ c.23.16.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
dltgkkiailaadgveeieltspraaieaaggttelislepgeiqsmkgdiepqekyrvd
hvvsevqvsdydglllpggtvnpdklrleegamkfvrdmydagkpiaaichgpwslsetg
iaqglkmtswsslkreltlagaqwvdeecvtdkgvvtsrkpddlpafnkkiveefaegdh
ssrrk
Timeline for d2vrna_: