Lineage for d2vrna_ (2vrn A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589536Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1589537Protein automated matches [190197] (15 species)
    not a true protein
  7. 1589551Species Deinococcus radiodurans [TaxId:243230] [188648] (1 PDB entry)
  8. 1589552Domain d2vrna_: 2vrn A: [168773]
    automated match to d1oi4a1
    complexed with mg

Details for d2vrna_

PDB Entry: 2vrn (more details), 2.15 Å

PDB Description: the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily
PDB Compounds: (A:) protease I

SCOPe Domain Sequences for d2vrna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrna_ c.23.16.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
dltgkkiailaadgveeieltspraaieaaggttelislepgeiqsmkgdiepqekyrvd
hvvsevqvsdydglllpggtvnpdklrleegamkfvrdmydagkpiaaichgpwslsetg
iaqglkmtswsslkreltlagaqwvdeecvtdkgvvtsrkpddlpafnkkiveefaegdh
ssrrk

SCOPe Domain Coordinates for d2vrna_:

Click to download the PDB-style file with coordinates for d2vrna_.
(The format of our PDB-style files is described here.)

Timeline for d2vrna_: