Lineage for d2vria_ (2vri A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881815Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. 2881816Protein automated matches [190146] (12 species)
    not a true protein
  7. 2881839Species Human coronavirus nl63 [TaxId:277944] [188918] (1 PDB entry)
  8. 2881840Domain d2vria_: 2vri A: [168772]
    automated match to d2acfa1
    complexed with edo

Details for d2vria_

PDB Entry: 2vri (more details), 1.9 Å

PDB Description: structure of the nsp3 x-domain of human coronavirus nl63
PDB Compounds: (A:) non-structural protein 3

SCOPe Domain Sequences for d2vria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vria_ c.50.1.0 (A:) automated matches {Human coronavirus nl63 [TaxId: 277944]}
kagsaaapftkpfavyknvkfylgdishlvncvsfdfvvnaanenllhgggvaraidilt
egqlqslskdyissngplkvgagvmlecekfnvfnvvgprtgkhehsllveaynsilfen
giplmpllscgifgvrienslkalfscdinkplqvfvyssneeqavlkfldgl

SCOPe Domain Coordinates for d2vria_:

Click to download the PDB-style file with coordinates for d2vria_.
(The format of our PDB-style files is described here.)

Timeline for d2vria_: