Lineage for d2vrfd1 (2vrf D:112-200)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395895Domain d2vrfd1: 2vrf D:112-200 [168771]
    Other proteins in same PDB: d2vrfa2, d2vrfa3, d2vrfb2, d2vrfb3, d2vrfc2, d2vrfc3, d2vrfd2, d2vrfd3
    automated match to d1qava_
    complexed with edo

Details for d2vrfd1

PDB Entry: 2vrf (more details), 2 Å

PDB Description: crystal structure of the human beta-2-syntrophin pdz domain
PDB Compounds: (D:) beta-2-syntrophin

SCOPe Domain Sequences for d2vrfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrfd1 b.36.1.1 (D:112-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvrrvrvvkqeagglgisikggrenrmpiliskifpglaadqsralrlgdailsvngtdl
rqathdqavqalkragkevllevkfirev

SCOPe Domain Coordinates for d2vrfd1:

Click to download the PDB-style file with coordinates for d2vrfd1.
(The format of our PDB-style files is described here.)

Timeline for d2vrfd1: