Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d2vrfd1: 2vrf D:112-200 [168771] Other proteins in same PDB: d2vrfa2, d2vrfa3, d2vrfb2, d2vrfb3, d2vrfc2, d2vrfc3, d2vrfd2, d2vrfd3 automated match to d1qava_ complexed with edo |
PDB Entry: 2vrf (more details), 2 Å
SCOPe Domain Sequences for d2vrfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrfd1 b.36.1.1 (D:112-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvrrvrvvkqeagglgisikggrenrmpiliskifpglaadqsralrlgdailsvngtdl rqathdqavqalkragkevllevkfirev
Timeline for d2vrfd1: