SCOPe 2.08: Domain d2vr6f_: 2vr6 F:

Lineage for d2vr6f_ (2vr6 F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)

8. Domain d2vr6f_: 2vr6 F: [168763]
   automated match to d1hl4a_
   complexed with cu, scn, so4, zn; mutant

Details for d2vr6f_

PDB Entry: 2vr6, 1.3 Å

PDB Description: crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.3 a resolution

PDB Compounds: (F:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2vr6f_:

Sequence; same for both SEQRES and ATOM records:

>d2vr6f_ b.1.8.1 (F:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Timeline for d2vr6f_:

• d2vr6f_ first appeared in SCOPe 2.01
  
• d2vr6f_ appears in SCOPe 2.07