| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
| Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
| Protein automated matches [190767] (7 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [188473] (5 PDB entries) |
| Domain d2vq8a1: 2vq8 A:-1-126 [168761] Other proteins in same PDB: d2vq8a2 automated match to d1un5a_ complexed with cl |
PDB Entry: 2vq8 (more details), 1.35 Å
SCOPe Domain Sequences for d2vq8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vq8a1 d.5.1.0 (A:-1-126) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mqpehvkeryknflnqhvgpdmsvqrcnseigpnnrkitlsgtdngckpvntfilankrl
iktvcgragspqgnmvrsnqpfpvvkcvlnngerhpyceyrgtrstryivlkceegwpvh
yhedevn
Timeline for d2vq8a1: