SCOPe 2.08: Domain d2vq8a1: 2vq8 A:-1-126

Lineage for d2vq8a1 (2vq8 A:-1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (7 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188473] (5 PDB entries)

8. Domain d2vq8a1: 2vq8 A:-1-126 [168761]
   Other proteins in same PDB: d2vq8a2
   automated match to d1un5a_
   complexed with cl

Details for d2vq8a1

PDB Entry: 2vq8, 1.35 Å

PDB Description: rnase zf-1a

PDB Compounds: (A:) RNAse zf-1a

SCOPe Domain Sequences for d2vq8a1:

Sequence; same for both SEQRES and ATOM records:

>d2vq8a1 d.5.1.0 (A:-1-126) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mqpehvkeryknflnqhvgpdmsvqrcnseigpnnrkitlsgtdngckpvntfilankrl
iktvcgragspqgnmvrsnqpfpvvkcvlnngerhpyceyrgtrstryivlkceegwpvh
yhedevn

Timeline for d2vq8a1:

• d2vq8a1 first appeared in SCOPe 2.01, called d2vq8a_
  
• d2vq8a1 appears in SCOPe 2.07