Lineage for d2vq8a1 (2vq8 A:-1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928655Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 2928656Protein automated matches [190767] (7 species)
    not a true protein
  7. 2928681Species Zebrafish (Danio rerio) [TaxId:7955] [188473] (5 PDB entries)
  8. 2928682Domain d2vq8a1: 2vq8 A:-1-126 [168761]
    Other proteins in same PDB: d2vq8a2
    automated match to d1un5a_
    complexed with cl

Details for d2vq8a1

PDB Entry: 2vq8 (more details), 1.35 Å

PDB Description: rnase zf-1a
PDB Compounds: (A:) RNAse zf-1a

SCOPe Domain Sequences for d2vq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vq8a1 d.5.1.0 (A:-1-126) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mqpehvkeryknflnqhvgpdmsvqrcnseigpnnrkitlsgtdngckpvntfilankrl
iktvcgragspqgnmvrsnqpfpvvkcvlnngerhpyceyrgtrstryivlkceegwpvh
yhedevn

SCOPe Domain Coordinates for d2vq8a1:

Click to download the PDB-style file with coordinates for d2vq8a1.
(The format of our PDB-style files is described here.)

Timeline for d2vq8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vq8a2