Lineage for d1scfd_ (1scf D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991662Protein Stem cell factor, SCF [47299] (1 species)
    forms dimer similar to the M-CSF and Flt3 ligand dimers
  7. 1991663Species Human (Homo sapiens) [TaxId:9606] [47300] (3 PDB entries)
  8. 1991667Domain d1scfd_: 1scf D: [16876]
    complexed with 1pe, ca

Details for d1scfd_

PDB Entry: 1scf (more details), 2.2 Å

PDB Description: human recombinant stem cell factor
PDB Compounds: (D:) stem cell factor

SCOPe Domain Sequences for d1scfd_:

Sequence, based on SEQRES records: (download)

>d1scfd_ a.26.1.2 (D:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
nvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnisegl
snysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsidafk

Sequence, based on observed residues (ATOM records): (download)

>d1scfd_ a.26.1.2 (D:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
nvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnisegl
snysiidklvnivddlvecvspeprlftpeeffrifnrsidafk

SCOPe Domain Coordinates for d1scfd_:

Click to download the PDB-style file with coordinates for d1scfd_.
(The format of our PDB-style files is described here.)

Timeline for d1scfd_: