SCOPe 2.08: Domain d1scfd_: 1scf D:

Lineage for d1scfd_ (1scf D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Stem cell factor, SCF [47299] (1 species)
   forms dimer similar to the M-CSF and Flt3 ligand dimers

7. Species Human (Homo sapiens) [TaxId:9606] [47300] (3 PDB entries)

8. Domain d1scfd_: 1scf D: [16876]
   complexed with 1pe, ca

Details for d1scfd_

PDB Entry: 1scf, 2.2 Å

PDB Description: human recombinant stem cell factor

PDB Compounds: (D:) stem cell factor

SCOPe Domain Sequences for d1scfd_:

Sequence, based on SEQRES records:

>d1scfd_ a.26.1.2 (D:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
nvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnisegl
snysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsidafk

Sequence, based on observed residues (ATOM records):

>d1scfd_ a.26.1.2 (D:) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
nvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnisegl
snysiidklvnivddlvecvspeprlftpeeffrifnrsidafk

Timeline for d1scfd_:

• d1scfd_ first appeared (with stable ids) in SCOP 1.55
  
• d1scfd_ appears in SCOPe 2.07