SCOPe 2.05: Domain d2vphb_: 2vph B:

Lineage for d2vphb_ (2vph B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (42 PDB entries)

8. Domain d2vphb_: 2vph B: [168758]
   automated match to d2cs5a1

Details for d2vphb_

PDB Entry: 2vph, 1.9 Å

PDB Description: crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, pdz domain

PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type 4

SCOPe Domain Sequences for d2vphb_:

Sequence, based on SEQRES records:

>d2vphb_ b.36.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvling
rdiaehthdqvvlfikascerhsgelmllvrpnavestv

Sequence, based on observed residues (ATOM records):

>d2vphb_ b.36.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdnlvlirmkpdngrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikaselmllvrpnavestv

Timeline for d2vphb_:

• d2vphb_ first appeared in SCOPe 2.01
  
• d2vphb_ appears in SCOPe 2.04
  
• d2vphb_ appears in SCOPe 2.06
  
• d2vphb_ appears in the current release, SCOPe 2.08, called d2vphb1