SCOPe 2.08: Domain d2vpha1: 2vph A:513-606

Lineage for d2vpha1 (2vph A:513-606)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)

8. Domain d2vpha1: 2vph A:513-606 [168757]
   Other proteins in same PDB: d2vpha2, d2vphb2, d2vphb3
   automated match to d2cs5a1

Details for d2vpha1

PDB Entry: 2vph, 1.9 Å

PDB Description: crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, pdz domain

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 4

SCOPe Domain Sequences for d2vpha1:

Sequence; same for both SEQRES and ATOM records:

>d2vpha1 b.36.1.1 (A:513-606) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikascerhsgelmllvrpnav

Timeline for d2vpha1:

• d2vpha1 first appeared in SCOPe 2.01, called d2vpha_
  
• d2vpha1 was called d2vpha_ in SCOPe 2.07